WIT   39 Genomes
Home FAQ Credits
 
General Overview View Models Curate Models User Settings Query Pathways
General Search Similarity Search Ortholog Clusters Operons Query Enzymes
ClustalW AA-ALignment
 WIT  Results ClustalW AA-ALignment

This Amino Acid alignment below is generated with ClustalW, an excellent alignment program written by Desmond Higgins and coworkers. We are most grateful for being able to use it.

 CLUSTAL W (1.7) multiple sequence alignment
 
 
 RBS01824        -----------------------------------------------------MAELI-H
 RTH01137        ------------------------------------------------------MVFT-E
 RMT04593        ---------------------------------VAAAEVVDPNRLSYDRG-PSAPSLL-E
 RPA00539        -----------------------------------------MNQPSYTSG-RQDVALL-A
 RAG50253        ----------------------MLGVEGKSITEIDEKEINRIWLKHYDEGVRPNIDYP-E
 RDR02856        ----------------------MTSIP--AVPAAPSGSLPRPWLTSYEPGVPQDLAPS-S
 RBS02850        ------------------------------------MQSQKPWLAEYPNDIPHELPLP-N
 REC05109        --------------------------------------MKKVWLNRYPADVPTEINPDRY
 RHI08067        --------------------------------------MEKIWFQNYPKGSEKFLDTSKY
 RNG00581        --------------------------------------MEKIWLESYEKGVSAEIDITQY
 RNM01387        --------------------------------------MEKIWLDSYEKGVSAEIDITQY
 RPA06952        -------------------------------------MIENFWKDKYPAGIAAEINPDQY
 RPA06953        -------------------------------------MQPEFWNDKRPAGVPDSLDFAAY
 RNG01013        ------------------------------------------------------------
 RNM01768        ------------------------------------------------------MNRT-Y
 RML00516        ------------------------------------------------------------
 RMT04495        ---------------------------------------------VREISVPAPFTVGEH
 RCE10267        MRSILVSRRFAHVLTSTHAAPSTSNIPTTDSHHLTHPSVHRQHTNSYIHG-TSNIPLR-N
 RAG48341        ----------------------------------------------MKVVKDPELKIERK
 RML00425        ------------------------------------------------------------
 REC01658        -------------------MHPTGPHLGPDVLFRESNMKVTLTFNEQRRAAYRQQGLWGD
 RHI00001        ------------------------------------------------------MNLD--
 RPG00364        ------------------------------------------------------------
 RRC00290        ----------------------------------MTETYATVADRDRVEGQMPWEDRDRA
 RAA00428        ------------------------------------------------------------
 RBB00164        ----------------------------------------------------------MS
 RTP00336        ---------------------------------------------MSVCCTSSEERIERS
 RBB00597        ------------------------------------------------------------
 RCY06372        --------------------------------------------------MVTPINYHSI
 RPG00996        ---------------------------------------------------------MIE
                                                                             
 
 RBS01824        STIGRLLEQTADAYPDRDAVVYPDRN------IRYTYAQFDSL-CRQTAKGLM-RMGIGK
 RTH01137        DTIGEFFEKQVERYADKEFIVYPDRD------LRFTYREFNER-VNLLAKGLL-SIGIGK
 RMT04593        STIGANLAATAARYGHREALVDMVAR------RRFNYSELLTD-VHRLATGLV-RAGIGP
 RPA00539        TTVGDAFDATVARHAEREALVVRHQR------LRYSWRQLAER-VDAYARAFI-ALGLRP
 RAG50253        IPLYQLLEDTAKKYPDKTALIFFGK--------KITYRELDEM-SDRIAGFLK-SLGIKK
 RDR02856        RTLYRLLEDAATRYPNREALQFLGQ--------GTTFRELLKR-VRRFAKALQ-RSGVQQ
 RBS02850        KTLQSILTDSAARFPDKTAISFYGK--------KLTFHDILTD-ALKLAAFLQ-CNGLQK
 REC05109        QSLVDMFEQSVARYADQPAFVNMGE--------VMTFRKLEER-SRAFAAYLQQGLGLKK
 RHI08067        ESILDMFDKAVREHPDRPAYINMGQ--------VLTFRKLEER-SRAFAAYLQNEFKLQR
 RNG00581        NSVSDVFRQSVEKFARLPAFQNMGK--------TLTYAETGKL-ATDFASYLQNVLKLPR
 RNM01387        NSVSDVFRQSVEKFADQPAFQNMGK--------TLTYAETGKL-ATDFASYLQNVLKLPR
 RPA06952        PNILSVLKESCQRFATKPAFTNLGK--------TLTYGELYKL-SGDFAAYLQQHTDLKP
 RPA06953        RSVVEVFERSCKKFADRPAFSNLGV--------TLSYAELDRL-SAAFAAYLQKQTDLQP
 RNG01013        ------------------------------------------------------------
 RNM01768        ANFYEMLTAACRKNGNGTAVFDGKE--------KTAYRALKQE-AEAVAAYLQ-NIGVKF
 RML00516        ------------------------------------------------------------
 RMT04495        DNVAAMVFEHERDDPDYVIYQRLIDG------VWTDVTCAEAANQIRAAALGLISLGVQA
 RCE10267        ETLGQTLRNTTERVPDKEFCVFSKYP------IRKTYEEFYHD-VRQMAASLY-TLGLEK
 RAG48341        ESLNKMLWNTVQSHPRVSAIGYWDDGK----LKYLTYEEFWER-VRKLSKFLI-SSGLRK
 RML00425        ------------------------------------------------------------
 REC01658        ASLADYWQQTARAMPDKIAVVDNHG-------ASYTYSALDHA-ASCLANWML-AKGIES
 RHI00001        LHFVHRIQQQAKTRTNMTALRYKEHGL----WRDISWKNFQEQ-LNQLSRALL-AHNIDV
 RPG00364        ------------------------------------------------------------
 RRC00290        VTIYDFLSRVAAKHGSRPALTFQITSGPKDHSLTMTWAEVLAR-VTQAANLLR-RMGVGE
 RAA00428        ---MEFLRDFG-----KTALIHQGN--------EISYAELLEN-IASFANLMD----ITP
 RBB00164        DTVPKRFKDVVALYSELDIFMYKEGESKS--FKKQIYADFWNETKRVASGLLH--CGIKR
 RTP00336        KNLVHLVAQVAGAYAQLPAQYAKSSSG---VFEITSFSSFYEH-VCLFAAGLA-SIGCGR
 RBB00597        MSIAKAFFEVADQQKDKIAQMYKVCNG----YAHVTYGDLKNN-VLKLASFLK-SINVKH
 RCY06372        HCLADIWAITGENFADIVALNDRHSHP----PVTLTYAQLREE-ITAFAAGLQ-SLGVTP
 RPG00996        QNFIRLYQDSFREHWALPALTNYDTK------ESYTYGEMAADIARRHLLFER--IGLKP
                                                                             
 
 RBS01824        GDHVAIWASNISEWLAVQFATAKIGAVLVTVNTNYQAHELDYLLKQSDAAALIIMDS--Y
 RTH01137        GDHVGIWATNVPDWLTFLFATAKIGAVLVTVNTAYKSHELEYVMKQSDMKALAIIDG--F
 RMT04593        GDRVGIWAPNRWEWVLVQYATAEIGAILVTINPAYRVREVEYALRQSGVAMVIAVAS--F
 RPA00539        GERLGIWAPNCAEWCITQFASAKVGAVLVNINPAYRSSELEYALKQSGCSWLICADA--F
 RAG50253        GDRVILDLPNVPQYVAAYYGILKVGATVVQCNPLYTEREIRYIQENSEAEYGFFVEF--V
 RDR02856        GDRVAIMLPNCPQFVVAFYGTLLAGAVVVNTSPLYTAAELEHQLSDSGSETLVILDS--L
 RBS02850        GDRVAVMLPNCPQTVISYYGVLFAGGIVVQTNPLYTEHELEYQLRDAQVSVIITLDL--L
 REC05109        GDRVALMMPNLLQYPVALFGILRAGMIVVNVNPLYTPRELEHQLNDSGASAIVIVSN--F
 RHI08067        GDRVALMMPNLLQYPIALFGILRAGLIAVNVNPLYTPRELELQLQDSGAVAIVVVSN--F
 RNG00581        GERVAIMMPNVLQYPIALFGILQAGLVAVNTNPLYTPRELEHQLKDSGATAIIVLEN--F
 RNM01387        GERVAIMLPNVLQYPVALFGILQAGLVAVNTNPLYTPRELEHQLKDSGATAIIVLEN--F
 RPA06952        GDRIAVQLPNVLQYPIVVFGAMRAGLIVVNTNPLYTARELEHQFNDSGAKAVVCLAN--M
 RPA06953        GDRIAVQMPNVLQYPIAVFGALRAGLVVVNTNPLYTAREMRHQFKDAGVRALVYLNV--F
 RNG01013        ------------------------------------------------------------
 RNM01768        GDTVALAVSNSTEFITAYFAVSAIGAVAVPMNTFLKNSEYAYILNDCKARFLFASAG--L
 RML00516        ------------------------------------------------------------
 RMT04495        GDRVVIFSATRYEWAILDFAILAVGAVTVPTYETSSAEQVRWVLQDSEAVVLFAETD--S
 RCE10267        GDRVGVWGPNYYEWVVLQYACAFAGVIQVNVNPHYLHEELRFVMRKTGMKVLFAPKR--H
 RAG48341        GDRVAIYADTRYEWEIADFAVLTAGGVVVTVHSVLNREQVEYILRDSESRVVFTEKK--Y
 RML00425        ------------------------------------------------------------
 REC01658        GDRIAFQLPGWCEFTVIYLACLKIGAVSVPLLPSWREAELVWVLNKCQAKMFFAPTL--F
 RHI00001        QDKIAIFAHNMERWTIVDIATLQIRAITVPIYATNTAQQAEFILNHADVKILFVGDQEQY
 RPG00364        -----LFVGEQFQYNNAYRVQKEYGTLKR-----IVVFDERVVLNPEDKTSKYFSEFVRL
 RRC00290        KDTVAYLLPNSLETAVVLLGGATAGIVNP-INPLLEPEQISAILRETKAKVLVTLKS--F
 RAA00428        NERVGIVMENRPEWVYAFYGTWKKGGIVVPIDFMSTPQEIRYILEDAEPSIIFCSDE--T
 RBB00164        GEKVVIISDSRREWIIIDVATLGLGCVDVPRGNDSSEDELAYIINHSESTFIFVENNKQL
 RTP00336        GDCIGLISDNRVEWLHASFGIQALGAADVPRGSDATERDLVQILGAVEARTVIVENDAQL
 RBB00597        QDKIFICSENRAEWTVIDFAILSLGAVDIPKGSDVTLFEAEIIFNSVLPSVVILENLNLL
 RCY06372        HQHLAIFADNSPRWFIADQGSMLAGAVNAVRSAQAERQELLYILEDSNSRTLIAENRQTL
 RPG00996        GDKVALLGKDSAEWCMAFMSVITYGAIIVPVLPDFNAADAASIVTHSDAKYLFVSDK--I
                                                                             
 
 RBS01824        RGTSYPDIVNSLIPELQEAK------------PGQ--------LKS--------------
 RTH01137        RDVDYVQTLYELVPELKTHE------------RGH--------LRS--------------
 RMT04593        KDADYAAMLAEVGP----------------------------------------------
 RPA00539        KTSDYHAMLGDLLPELARAR------------PGE--------LAS--------------
 RAG50253        YPRIKGLLAEGKLKKAVICK------------IED--------YLP--------------
 RDR02856        YPRYAEVADKVPVKRVLVSR------------IQD--------ELP--------------
 RBS02850        FPKAIKMKTLSIVDQILITS------------VKD--------YLP--------------
 REC05109        AHTLEKVVDKTAVQHVILTR------------MGD--------QLS--------------
 RHI08067        ASTLEKVVFNTNVKHVILTR------------MGD--------QLS--------------
 RNG00581        ANTLELVLPRTQIKHVIVAS------------VGE--------MFG--------------
 RNM01387        ANTLELVLPRTQIKHVIVAS------------VGE--------MFG--------------
 RPA06952        AHLVEGVLPKTGVKQVIVTE------------VGD--------ILP--------------
 RPA06953        GKLVEEVLPDTRIEYLIEAR------------MGD--------LLP--------------
 RNG01013        ------------------------------------------------------------
 RNM01768        SKELAGLKAQTPVEKIIWT--------------GQ--------SRP--------------
 RML00516        ------------------------------------------------------------
 RMT04495        HATMVAELSGSVPALREVLQ------------IAG--------SGPNALDRLTEAGASVD
 RCE10267        KHSNYVHTMLEAMPEMRRGQP----------GVGH--------IKS--------------
 RAG48341        AENVPEDFEVYFLEELEKLVG----------EVSDD-------EFESR------------
 RML00425        ------------------------------------------------------------
 REC01658        KQTRPVDLILPLQN----------------------------------------------
 RHI00001        DQTLEIAHHCPKLQKIVAMKS----------TIQLQ-------QDPLSCTWESFIKTGSN
 RPG00364        GDSMPNETKVKVSS----------------------------------------------
 RRC00290        PKSDIAQKAAEAVKHAPNVKT----------ILEVD-------LN---------------
 RAA00428        YPRVREASEDLKVEIVN---------------VDN-------------------------
 RBB00164        HKVLSKKHDLRLVRCIVVIDDD----KSYEEKIGNI-------TVFSYKKLLELGTEYLR
 RTP00336        KKLARCFDALPSVSQIVLLDAGGAYQAMKDEFVQNEDGSARKCSFFTYQDILAHGTQFRV
 RBB00597        NMFIQIKFTVKPIFIIIENLN-----------QEDR---LKYSDFEIYTYSDCILFGDTL
 RCY06372        SKLALDGETIDLKLIILLTDEEVAEDSAIPQYNFAQVMALGAGKIP--------------
 RPG00996        WETMDPSQLLLLCGAVS---------------IR--------------------------
                                                                             
 
 RBS01824        ---------ERYPFLKTLIYIGNKR-LSGMYHWDDTEILAKTVTDAELEERMNSLDK---
 RTH01137        ---------ERFPELRSVIYIGAQK-HRGMYNTNELMLLGKHVPDTELRTVMSTLKN---
 RMT04593        ----------RCPDLADVILLES-------DRWDALAG--AEPDLPALQQTAARLDG---
 RPA00539        ---------ERLPELRGVISLAERA-PAGFLHWQGLPGLAAAVGAEELRQRQASLQF---
 RAG50253        ---------FPLNILYPLK-KEKVR-IEKSDKVVYWKDALKSPLTKERPEINPK------
 RDR02856        ---------FPKNLLFPIK-ALKEG-TLASDSFKRNPRAVPMRFVTKLQDPDPVSVPITA
 RBS02850        ---------FPKNILYPLTQKQKVH-IDFDKTANIHTFASCMKQEKTELLTIPKIDP--E
 REC05109        ---------TAKGTVVNFVVKYIKR-LVPKYHLPDAISFRSALHNGYRMQYVKPELV--P
 RHI08067        ---------FGKRTLVNFVVKYVKK-LVPKYKLPHAVTFREVLSIGKYRQYVRPEIS--R
 RNG00581        ---------LLKGSLINFIIRKIKK-MVPEYRIRETVSFQTALKEGAKHVFQPVALN--R
 RNM01387        ---------LLKGSLINFVIRKIKK-MVPEYRIRETVSFQTALKEGAKHVFQPVALN--R
 RPA06952        ---------PLKRFIVNFVVKHIKK-MVPAYSLPQATKLTDALARGAGKSFQEAAPQ--A
 RPA06953        ---------ALKGWLVNSVVKSVKK-MVPDYRLPQALPFRQALKQGQGHALQPVRVG--L
 RNG01013        ------------------------------------------------------------
 RNM01768        ---------DGEMAEGDAFFEDVRR-FPEKPDLGR----------------QPR-----I
 RML00516        ------------------------------------------------------MLQPGQ
 RMT04495        PAE-LTARLAALRSTDPATLIYTSG-TTGRPKGCQLTQSNLVHEIKGARAYHPTLLRKGE
 RCE10267        ---------HDIPELRHIVLYGDDVPVHGAWVYSDLIHAAGSAERAKLEDMDRKLRP---
 RAG48341        ---------WKSVEPDDLASIVYTSGTTGEPKGAMLTHWNWRFNCHSVMSITPFYPG--E
 RML00425        ------------------------------------------------------------
 REC01658        ----------QLPQLQQIVGVDKLAPATSSLSLSQIIA-----DNTSLTTAITTHG----
 RHI00001        AQQDELTQRLNQKQLSDLFTIIYTSGTTGEPKGVMLDYANLAHQLETHDLSLNVTDQ--D
 RPG00364        ----------REAIPSDPALIIYTSGTSGRSKGVLLLHSNLMYQMKVHSEHIPVYGP-GE
 RRC00290        ----------RYLTAPKSWIVPFVRPKTHFRHHADVYDFNTACDGQPADKLVFADAT--A
 RAA00428        ---------LVLPTPWEGIVRRDED-DVAVLPYTSGTTGNPKGVMLTFKNLMSNIRG---
 RBB00164        ANPKSFDMEIEKGSSKDIATIIYTSGTTGMPKGVMLRHESFIFQLDRLYDYLPTLKP-GK
 RTP00336        HHPGRIEDEIGRTTRADVATIIFTSGTTGTPKGVVLSHENFLCQLIDISRRLTVCPG--D
 RBB00597        RKDSEIIEIASKVDSNDMATIIYTSGTTGHPKGVMLSHANLLYQVSSFSLMVDTHVG--Q
 RCY06372        --------TPVPRQEEDLATLIYTSGTTGQPKGVMLSHGNLLHQVRELDSVIIPRPG--D
 RPG00996        ----------DYTVFLDRTEGGLLSQEVEGLSRSFSEHYPSGFTAEDIRYAEVSN-----
                                                                             
 
 RBS01824        DNVINMQYTSGTTGFPKGVMLTHFNVINNAANIAECMALTS--------Q--DRMCIPVP
 RTH01137        TDVINMQYTSGTTGFPKGVMLTHRNILNNGYYIGERQRFTE--------E--DRLCLPVP
 RMT04593        SDPVNIQYTSGTTAYPKGVTLSHRNILNNGYLVGELLGYTA--------Q--DRICIPVP
 RPA00539        DEPINIQYTSGTTGFPKGATLSHYNILNNGYMVGESLGLGA--------E--DRLVIPVP
 RAG50253        DDVAIFLYTGGTTGVPKAVMSTHFNLVANVYQTLEWVVDRT--------P-DDVFIGVLP
 RDR02856        DDVALLQYTGGTTGVPKGAMLTHRNLVANAEQCRSWMVGLQ--------EGREITMAAIP
 RBS02850        HDIAVLQYTGGTTGAPKGVMLTHQNILANTEMCAAWMYDVK--------EGAEKVLGIVP
 REC05109        EDLAFLQYTGGTTGVAKGAMLTHRNMLANLEQVNATYGPLL-------HPGKELVVTALP
 RHI08067        EDLAFLQYTGGTTGVAKGAMLTHGNIITNVFQAKWIAEPFIGD-----HSRTRSAILALP
 RNG00581        EDTALLQYTGGTTGVARGAVLSHGNICANMLQAKEWIKNQLR-------EGKETVIAALP
 RNM01387        EDTALLQYTGGTTGVAKGAVLSHGNICANMLQAKEWIKNQLR-------EGKETVIAALP
 RPA06952        DDVAVLQYTGGTTGVAKGAMLTHRNLVANMLQCKALM---GAN----LNEGCEILIAPLP
 RPA06953        EDVAVLQYTGGTTGVSKGAMLTHGNLVANMLQVHAQLSQLGKDGLPLMKEAQEVMIAPLP
 RNG01013        ------------------------------------------------------------
 RNM01768        NDLAHIIYTSGTTGHPKGALISYANLFANLNGIERIFKISK--------R--DRFIVFLP
 RML00516        RLLVFLPLAHVLARALTLSAFTYKMTVGFTSDIKNLLPMLA--------VFKPTVVVSVP
 RMT04495        RLLVFLPLAHVLARAISMAAFHSKVTVGFTSDIKNLLPMLA--------VFKPTVVVSVP
 RCE10267        DEPVNMQFTSGTTGHPKGATLTHFGLNNNAYFAGIRLGWDR--------E-DHRICIPNP
 RAG48341        PHICYLPLSHVYQRLVFFAGISRAATAVFCSPQQFLETSTA-------VKPVGLIVVPRI
 RML00425        -------------------------------------------------------MLPAP
 REC01658        DELAAVLFTSGTEGLPKGVMLTHNNILASERAYCARLNLTW----------QDVFMMPAP
 RHI00001        ISLSFLPFSHIFERAWAAYILHRGAILCYLEDTNQVRSALT--------EIRPTLMCAVP
 RPG00364        LSIAFLPMSHIFEKAWTLFCLTTGTRIAILRDPKKVLEALP--------QIRPSLMCNVP
 RRC00290        DRVAAYFHTGGTTGMPKVAQHKYSGMVYNGWLGGTLLFRHT-----------DVMICPLP
 RAA00428        --VSEVGIAGKEDKTLAILPFHHMYPLMTTMLLPLYLG--------------ATVVFLDK
 RBB00164        IMISILPLWHSFERACEYIVALKGIAIAYSKPIGPVLLKDFL-------LLNPQMIVSVP
 RTP00336        IALSVLPVWHVFERISEYVVLSHAGGVAYSKPVGSVMLADLA-------KLNPHFLPSVP
 RBB00597        IFMCILPIWHSFQRSFSYNIFLKGMVCLFSTIVPRAMLDDIK-------NVNPHYIAAVP
 RCY06372        QVLSILPCWHSLERSAEYFLLSRGCTMNYTSIRHFKGDVKD---------IKPHHIVGVP
 RPG00996        DDLILLNYTSGTTGFSKGVMLRANNLAGNVTYVKDRDIMFR----------GETILCFLP
                                                                             
 
 RBS01824        FFH-------------------------CFGCVLGVLACVSVGAAMIP---VQEFDPVTV
 RTH01137        LFH-------------------------CFGIVLGVLALLTHGGTLVM---IELFDPLLV
 RMT04593        FYH-------------------------CFGMVMGNLAATSHGAAMVIP--APGFDPAAT
 RPA00539        LYH-------------------------CFGMVMGNLGCVTHGSTMIYP--APSFDAEAT
 RAG50253        YFH-------------------------SFGMTTSMNAPIANGSTIVLI--PDPRDIKRI
 RDR02856        FFH-------------------------VYGMTVAMNLSMLIGATLVLV--PNARDIKMV
 RBS02850        FFH-------------------------VYGLTAVMNYSIKLGFEMILL--P-KFDPLET
 REC05109        LYH-------------------------IFALTINCLLFIELGGQNLLI--TNPRDIPGL
 RHI08067        LYH-------------------------VFALTVNCLLFLELGVTAILI--TNPRDIEGF
 RNG00581        LYH-------------------------IFALTVNLMIFANAGSKIVLI--ANPRDMKGF
 RNM01387        LYH-------------------------IFALTVNLMIFANAGSKIILI--TNPRDMKGF
 RPA06952        LYH-------------------------IYAFTFHCMAMMLTGNHNILI--TNPRDLPSM
 RPA06953        LYH-------------------------IYAFTANCMCMMVSGNHNVLI--TNPRDIPGF
 RNG01013        ------------------------------------------------------------
 RNM01768        MFH-------------------------SFTLTAMVLLPIYMACSIILV--KSVFPFSNV
 RML00516        RVF-------------------------EKVYNTAEQNAANEGKSRIFA--MAAQTAVEW
 RMT04495        RVF-------------------------EKVYNTAEQNAANAGKGRIFA--IAAQTAVDW
 RCE10267        LYH-------------------------CFGCAVGVINAVNHGQTVVFP--SKSYHVPDI
 RAG48341        LER-------------------------VNAGIVEKVEKSPALAKKIFY--WSRGVAIEC
 RML00425        MFH-------------------------ALGYLHATLA-MFLGSTLVL---RRRFKPATV
 REC01658        LGH-------------------------ATGFLHGVTAPFLIGARSVL---LDIFTPDAC
 RHI00001        RFYE-----------------------KIYAAVLDKVQKAPKLRQIMFH--WAISVGQKY
 RPG00364        RFWE-----------------------KVYQGVNEKMASSPRILKGVYR--RAMAVGQRY
 RRC00290        LFH-------------------------VFAAYPILMSAIHSGAHVVFPT-PAGYRGEGV
 RAA00428        LTPE-----------------------DIIEKLQKYQITVLIGVPRLYQL-FHRRIMEEI
 RBB00164        RIWEGIRIGIIKKVSE------SFIKKFVFGGFLKVGIIYAKLKERFLGLSPIYKKTNFL
 RTP00336        RIWEAIHDGIFKNVRKK-----GGVAAALFHFFLAAGKAYAYFYRSVFG---LRTHTTRR
 RBB00597        RLWIAIRQNIYKEVSKK-----PFISRMIFHFFVKAAFLSDICYRVVMG--LYPDNGFSL
 RCY06372        RLWESLYEGVQKTFRE---------KSPGQQKLINFFFGISQKYILAKRIANNLSLNHLH
 RPG00996        LAHTYSCAFNFLTPLTIGVHVYILGKIPSPLTLIKAFADVRPSFVIMVPLIIEKLYHKAI
                                                                             
 
 RBS01824        LKTVEK--EKCTVLHGVPTMFIAELHHPD--FDAYDLSTLRTGIMAGSPCPSEVMKAVIE
 RTH01137        LAAVEK--ERCTALYGVPTMFIAEFTHPM--FDMFDLSSLRTGIMAGSPCPIEAMKRVMN
 RMT04593        LRAVQD--ERCTSLYGVPTMFIAELGLPD--FTDYELGSLRTGIMAGAACPVEVMRKVIS
 RPA00539        LLAVAE--ERATALYGVPTMFIAELDHPR--RREFDLSSLRTGIMAGATCPIEVMRRVIG
 RAG50253        LESIQK--YRASIFCGVPTMYAAIINHPD--VKKYDLSSVKACISGAAPLPVEVKRRFEE
 RDR02856        LDEISR--TRATIFPGVPTLYNAINNHPD--TAAHDLTTIRACISGSAPLMQDTARTFRE
 RBS02850        LKIIDK--HKPTLFPGAPTIYIGLLHHPE--LQHYDLSSIKSCLSGSAALPVEVKQKFEK
 REC05109        VKELAK--YPFTAITGVNTLFNALLNNKE--FQQLDFSSLHLSAGGGMPVQQVVAERWVK
 RHI08067        VKELKK--YRFEAITGVNTLFNALLNNEN--FKEVDFSALKLSVGGGMAIQQSVATRWHE
 RNG00581        IGELKK--QRVNVFIGVNTLFNAMVNRPD--FAEVDFSGLRLTLGGGMATQKAVAEKWKK
 RNM01387        IGELKK--QRVNVFIGVNTLFNAMVNRPD--FAEVDFSELRLTLGGGMATQKAVAEKWKK
 RPA06952        LKDLGQ--WKFTGFVGLNTLFVALCNNET--FRKLDFSALKLTLSGGMALQLATAERWKE
 RPA06953        VKELKK--WRFSALLGLNTLFVALMEHPG--FKDVDFSNLKLTNSGGTALVSATAERWKG
 RNG01013        ------------MFLGVPAIYTAMSKAKIP-WYFRWFNRIRLFISGGAPLAEQTILDFKA
 RNM01768        LKQALL--KRATVFLGVPAIYTAMSKTKIP-WYFRWFNRIRLFISGGAPLAEQTILDFKA
 RML00516        SEASHR--GGPGLLLRARHAVFDRLVYRK--LRAALGGDCHASVSGGAPLGARLGHFYRG
 RMT04495        SEACDR--GGPGLLLRAKHAVFDRLVYRK--LRAALGGNCRAAVSGGAPLGARLGHFYRG
 RCE10267        FEAIQN--EKCTTMFGTPTMFIDVLKSPL--MKQFDISSLRGGVIGGAPCPMALCEKMVK
 RAG48341        GKRMSRG-EKYGFWLNIKRIIADRLVFSKI-RENLGLTRIRFVCSSAAELQKELAYMFNG
 RML00425        LEDIEK--HQATAMVVVPVMLSRILDTLENLETKSDLSSLRVVFVSGSQLGAELATRALE
 REC01658        LALLEQ--QRCTCMLGATPFVYDLLNVLE--KQPADLSALRFFLCGGTTIPKKVARECQQ
 RHI00001        FDLRANN-KAIPFLLKKQFALADKLVLSK--LRQLLGGRIKMMPCGGAKLEPAIGLFFHA
 RPG00364        RLDYWNEGKRAPLLLSMQYAFYNCTIFTLL-KRVLGLQRGRYFPTAGAPLSDEINIFLQS
 RRC00290        FDNFWKLVERWQVTFLITVPTAIAALMQR--KVDADISSLRTAISGSAPLPVELYNRFKD
 RAA00428        NKNVLAK-NLFKLMKKVKNQKIRKTVFKK--VHDAFGGRIKYMVSGGAKLPLDIAQDLTT
 RBB00164        ISLFSKLFLFIGIVLIFPIKLLGDILVFKK-IKNALGQNFEFGVSGGGALVDYVDYFFKA
 RTP00336        AQFCAPLFACVPWLLLVPLHFLGNVLVFR-KVRKKFGTSFKTAISGGGALPPNVDEFLYA
 RBB00597        FFPIKKILGIFGLICAFPFKALGNVLIFN-KINKILGNNFVVGITGGGSMPLSAVRFFNS
 RCY06372        ASAIARLVARCQALVLSPLHYLGDKIVYHK-VRQAAGGRLETLISGGGALARHLDDFYEI
 RPG00996        APKIKT--PLIKFLLRLPVLKKVIHKSIRSKLIESFGGNFRQIIIGGAALNDEVAHFLYR
                                                              ..             
 
 RBS01824        RMGMKDITIAYGQTEASPVITQTRANDSFIRRVETTGRALPHTEVKIVEPGTC--QEVQR
 RTH01137        DMNMKEVTIAYGLTEASPVFTQTSVDDPIEKRVETVGTPLPHIEVKIVDPETG--EELGP
 RMT04593        RMHMPGVSICYGMTETSPVSTQTRADDSVDRRVGTVGRVGPHLEIKVVDPATG--ETVPR
 RPA00539        DMHMAEVQIAYGMTETSPVSLQTGPDDGLELRVTTVGRTQPRLESKIVD-QTG--RVVPR
 RAG50253        IT-GGKLVEGYGLSETSPVALGNPVY--GLNKEGSIGIPFPDTYAVVIDDE-G--KVLPI
 RDR02856        ITQGANLVEGYGLTETSPVTHVNPIT--GEQKEGSIGLPLPGVDALIMDDA-G--QPVPT
 RBS02850        VT-GGKLVEGYGLSEASPVTHANFIW--GKNKPGSIGCPWPSTDAAIYSEETG--ELAAP
 REC05109        LT-GQYLLEGYGLTECAPLVSVNPYD--IDYHSGSIGLPVPSTEAKLVDDD-D--NEVPP
 RHI08067        LT-GCNIIEGYGMTECSPLIAACPIN--VVKHNGTIGVPVPNTDIKIIKDD-G--SDAKI
 RNG00581        IT-GTPIVEAYGLTEASPRVCCNPLN--IESYSGSIGLPVPSTEVELRDAN-G--KEVPV
 RNM01387        IT-GTPIVEAYGLTEASPGVCCNPLN--IESYSGSIGLPVSSTEVELRDAN-G--KEVPV
 RPA06952        VT-GCAICEGYGMTETAPVVSVNPF---QNIQVGTIGIPVPSTLCKVIGDD-G--QEVPL
 RPA06953        VT-GCTVVEGYGLTECSPVVTTNPYG--EQARLGTVGIPVVGTALKVIDEQ-G--NELPV
 RNG01013        KFPRAKLLEGYGLSEASPVVAVNTP---ERQKARSVGIPLPGLEAKAVDEE-L--VEVPR
 RNM01768        KFPRAKLLEGYGLSEASPVVAVNTP---ERQKARSVGIPLPGLEVKAVDEE-L--VEVPR
 RML00516        VG--LTIHEGYGLTETSAAITLNQAG---NVKVGTVGNLLPGNSMRIADD----------
 RMT04495        AG--LTIYEGYGLSGTSGGVAISQFN---DLKIGTVGKPVPGNSLRIADD----------
 RCE10267        EMRMTDFSVIYGSTETSPLVTMSELHVDPFERIKSVGSVMPHQELAIVDEF-G--VPVPT
 RAG48341        MG--IPVIEGYGMTETAAPSNLNPVG---RFKPGTVGPPIPGIEEAIAED----------
 RML00425        EL-GPVIYNMYGSTEIAFATIAGPKD--LQINSATVGPVVKGVKVKILDDS-G--KEVPR
 REC01658        RG--IKLLSVYGSTESSPHAVVNLDDP-LSRFMHTDGYAAAGVEIKVVDDA-R--KTLPP
 RHI00001        IG--INIKLGYGMTETTATVSCWHD---FQFNPNSIGTLMPKAEVKIGEN----------
 RPG00364        VN--IPIIVGYGLSETTATVSFYPQR---GFKIGSMGKVMPGLDARIDPDN---------
 RRC00290        AT-GVEICEGYGLTEATCLVSINPVD--GLKKVGSVGIPLPYSHVRILRKTEAGFVECAA
 RAA00428        LG--FTVIEGYGLTETSPIVSFNPPN---RIKLGSVGVPIKGVEVMTTSE----------
 RBB00164        VG--IKVLEGYGLTETGPILSVRRLK---GPVAKTVGPILPDVEYKVVGIDGR---VLPY
 RTP00336        IG--VRVLEGYGLTETAPVIAMRSER---RPVFGSVGTPCAYNEVKIVDDT-G--AQLPV
 RBB00597        IG--IELANAYGLTETSPGVASNKHK---KVIIGTCGKILPGTVAEIRDID-G--NKLKK
 RCY06372        TS--IPVLVGYGLTETAPVTNARVHK---HNLRYSSGRPIPFTEIRIVDMETK--EDLPP
 RPG00996        IG--FPLTVGYGMTECGPLISYEDHS---LWLPGSCGKSLSIMEVRIDHSGQE--RHSDS
                       .   ** :                    : *                       
 
 RBS01824        GMQGELCTRGYHVMKG-YYKDKDATRKAINHDG---WLFTGDLAVMDEDGYCRITGRLKD
 RTH01137        GEPGEICCRGYNVMKG-YYKMPEMTAEAIDEDG---WLHSGDLAVMDEDGYYSIVGRIKD
 RMT04593        GVVGEFCTRGYSVMAG-YWNDPQKTAEVIDADG---WMHTGDLAEMDPSGYVRIAGRIKD
 RPA00539        GEIGELCTRGYSVMLG-YWNDPQATAEAIDPAR---WMHTGDLAVMDDDGYVRIVGRSKD
 RAG50253        GEVGELVIKGPQVMKG-YYKMEEETKKVLVN----GWLLTGDMAKMDEDGYFYIVDRKKD
 RDR02856        GEVGELWVAGPMVMKG-YWNMPDETAKVLREYAGKTWLLTGDMATMDEQGFFRIVDRKKE
 RBS02850        YEHGEIIVKGPQVMKG-YWNKPEETAAVLRD----GWLFTGDMGYMDEEGFFYIADRKKD
 REC05109        GQPGELCVKGPQVMLG-YWQRPD-ATDEIIKNG---WLHTGDIAVMDEEGFLRIVDRKKD
 RHI08067        GEAGELWVKGDQVMRG-YWQRPE-ATSEVLKDG---WMATGDIVIMDESYSLRIVDRKKD
 RNG00581        GQPGELWVKGPQVMQG-YWNRPEETAKAIDACG---FLETGDIAVMDEKGRLKLVDRKKD
 RNM01387        GQPGELWVRGPQVMKG-YWNRPEETAKAIDARG---FLETGDIAVMDEKGWLKLVDRKKD
 RPA06952        GERGELCVKGPQVMKG-YWQRQEATDEILDADG---WLKTGDIAIIQEDGYMRIVDRKKD
 RPA06953        GERGELCVKGPQVMKG-YWQRPEATEEILDAEG---WLKTGDIAVIDEDGFVRIVDRKKD
 RNG01013        GEVGELIVRGGSVMRG-YLNMPAATDETIVN-G---WLKTGDFVTIDEDGFIFIVDRKKD
 RNM01768        GEVGELIVRGGSVMRG-YLNMPAATDETIVN-G---WLKTGDFVTIDEDGFIFIVDRKKD
 RML00516        ---GELLVRGNVVFSG-YWHNEQGTIEAFTEG----WFKTGDLGAIDEDGFLTITGRKKE
 RMT04495        ---GELLVRGGVVFSG-YWRNEQATTEAFTDG----WFKTGDLGAVDEDGFLTITGRKKE
 RCE10267        GAKGELWSRGYSTMLG-YWADHDKTNLAITRDR---WYKSGDTATMNEDGTINIVGRTRD
 RAG48341        ---GEILVRGDNVMKG-YWRKEAETRKTFTEDG---WLKTGDLGEFDEDGYLVFLGRKKH
 RML00425        GQVGRIFVGNAFPFEG-YTGGGG--KQIIDG-----LLSSGDVGYFDEHDLLYISGRDDE
 REC01658        GCEGEEASRGPNVFMG-YFDEPELTARALDEEG---WYYSGDLCRMDEAGYIKITGRKKD
 RHI00001        ---NEILVRGGMVMKG-YYKKPEETAQAFTEDG---FLKTGDAGEFDEQGNLFITDRIKE
 RPG00364        ---NEILVKGESVMSE-YYNLPEETAGAFTPDG---YFRTGDAGRMDPDGTLYFLERIKD
 RRC00290        DEVGEICVANPGVFDGSTYTEVDKNHDLFAEER---FLRTGDLGRIDPDGYLWITGRAKD
 RAA00428        ---GEIIVRGDNVMKG-YWKKPEETQKVIING----WFYTGDLGEIDEEGYIYITGRKKE
 RBB00164        GEKGELWVRSPQIMSG-YFKDKAKTSEVLTEDG---WFNTGDLVRLTINNEISIVGRSKD
 RTP00336        GYKGIVLVRGKNIMQG-YYKNPELTAQVLDADG---WFNTGDIGYRCVGGQIVLRGRKKD
 RBB00597        PGKGILFVKGPQVMLG-YYKDKEATCKIIGSDG---FLNTGDIAKLSKDNVVQIIGREKD
 RCY06372        ETQGLVLIRGPQVMQG-YYNKPEATAKVLDQEG---WFDSGDLGWVTPQNDLILTGRAKD
 RPG00996        GDVGEIQVRGENVCLG-YYKNAELTAELFTPDG---WMRTGDLGTIDSLGNIFIKGRSKT
                    .     .                  .          :**           :  *   
 
 RBS01824        MLIRGG-ENIYPREIEEFLYQHPAVLDVQVVGVPDAKFGEEAAAWIKLK-DGK-------
 RTH01137        MIIRGG-ENIYPREIEEFLHTMPGVKDVQVVGIPDEKYGEIVGAFIIRE-DGA-------
 RMT04593        LVVRGG-ENISPREIEELLHTHPDIVDGHVIGVPDAKYGEELMAVVKLRNDAP-------
 RPA00539        MIIRGG-ENIYPRELEEFFFTHPAVADVQVIGIPDERYGEEIVAWIKLH-PGH-------
 RAG50253        MIIAGG-YNIYPREVEEVLYEHPAVVEAAVVGVPDPYRGETVKAYIVLKPEYKG------
 RDR02856        LIIAGG-HNIYPREVEEVLTSHPAVLEAAAVGLPDPYRGETVHAVVALKPGMQ-------
 RBS02850        IIIAGG-YNIYPREVEEALYEHEAIQEIVVAGVPDSYRGETVKAFVVLKKGAK-------
 REC05109        MILVSG-FNVYPNEIEDVVMQHPGVQEVAAVGVPSGSSGEAVKIFVVKKDP---------
 RHI08067        IILVSG-FNVYPNEIEDVVMLNYKVSEAVAIGVPHAVSGETIKIFVVKKDD---------
 RNG00581        LVVVSG-FNVYPNEIEEFIAHHEKVMEVACIGVPNEKTGEALKVFVVKKDP---------
 RNM01387        LVVVSG-FNVYPNEIEEVIAHHGKVMEVACIGVPDEKTGEALKVFVVKKDP---------
 RPA06952        MILVSG-FNVYPNELEDVLATLPGVLQCAAIGIPDEKSGESIKVFVVVK-PGA-------
 RPA06953        LILVSG-FNVYPNEIEDVVMAHPKVASCAAVGIPDEKSGEAVKLFVVARDP---------
 RNG01013        LIISKG-QNVYPREIEEEIHKLDAVEAAAVIGVKDRYADEEIVAFVQLKEG--M------
 RNM01768        LIISKG-QNVYPREIEEEIYKLDAVEAAAVIGVKDRYADEEIVAFVQLKEG--M------
 RML00516        IIVTAGGKNVAPALLEDQLRAHPLISQALVVGDAKPFVGALITIDPEAFNGWKQRNSKAA
 RMT04495        IIVTAGGKNVAPAVLEDQLRAHPLISQAVVVGDAKPFIGALITIDPEAFEGWKQRNSKTA
 RCE10267        MIVKGG-ENVYPTEIEQFLHKLDYVADAHVVGVPDDRYGENICAWVRLRVEDEG------
 RAG48341        IIVLDTGKNVSPVPIEEELLKNPLVSDAVIIGDGKPYVTTLIVPNFSMLLEFADKNGIEY
 RML00425        MIVSGG-ENVFPAEVEDLISGHPEVVEATAIGVDDKEWGARLRAFVVKKQD---------
 REC01658        IIVRGG-ENISSREVEDILLQHPKIHDACVVAMSDERLGERSCAYVVLKAPHH-------
 RHI00001        LMKTSNGKYIAPQYIESKIGKDKFIEQIAIIADAKKYVSALIVPCFDSLEEYAKQLN---
 RPG00364        LYKTANGKYIAPQMIEGMLTKDPIIEQIAVIGDRFKYVSALVYPNWELVRQAAIKRG---
 RRC00290        LIIRGG-HNIDPAEIEEALLSHPSIAFAGAIGQPDAFAGELPCAYVELIKEA--------
 RAA00428        IIVLGSGKNVFPEEIESKILAKAPYIKEVGVFEKDGKLLALIYPDFEKVKELGITN----
 RBB00164        TIVLRGGENIEPEPLERVLGKSLFIENIMIVGQDQKFLGAVIVPNFDNLEKWANSSG---
 RTP00336        TVVLRGGENVEPVPLEMSMQESRFIARAVVVGQDERYLAALIVPDEAELRLWAEAQELR-
 RBB00597        TIVLNNGENVEPAPIEIKLEESALIEKAVVVGQDQKFLGALILPNFEEINKYLESVG---
 RCY06372        TIVLSNGENVEPQPIEDACLRSAYIDQIMLVGQDQKSLGALIVPNFDALQKWAETKNLQI
 RPG00996        MLLGSNGQNIYPEEIESKINNLSYVLESIVTER-DGRLIALIVPDRQAIEHKG-------
                          : .  :*                                            
 
 RBS01824        ----------SVSPDELKAYC-KGKIARHKI------------------PRYVIFTDDYP
 RTH01137        ----------DILEEDVRDYA-IQRIARYKV------------------PKHVFFVDEFP
 RMT04593        ----------ELTIERLREYC-MGRIARFKI------------------PRYLWIVDEFP
 RPA00539        ----------HADDEQLRAFC-KARIAHFKI------------------PRHFKFVDEFP
 RAG50253        ----------KVTEQEIIQFC-KERLAAYKV------------------PKLVEFRDELP
 RDR02856        -----------ATEKEIIAYC-RTLLSAYKA------------------PRSVEFRDELP
 RBS02850        -----------ADTEELDAFA-RSRLAPYKV------------------PKAYEFRKELP
 REC05109        ----------SLTEESLVTFC-RRQLTGYKV------------------PKLVEFRDELP
 RHI08067        ----------SLTRDELRNHC-RQYLTGYKV------------------PKEIEFRDELP
 RNG00581        ----------SLTKEELTAFC-RTGLTAYKV------------------PKDIEFRDELP
 RNM01387        ----------SLTKEELIAFC-RTELTAYKV------------------PKNIEFRDELP
 RPA06952        ----------TLTKEQVMQHM-HDNLTGYKR------------------PKAVEFRDSLP
 RPA06953        ----------SLSVEELKAYC-KENLTGYKI------------------PRQIVLKDALP
 RNG01013        ----------DLGEDEIRRHL-RTVLANFKI------------------PKQIHFKDGLP
 RNM01768        ----------DLGENEIRRHL-RTVLANFKI------------------PKQIHFKDGLP
 RML00516        DAAIGDLTTVPDLVAEVDAAV-KQANLSVSH------------------AESIRKFRILP
 RMT04495        GASVGDLATDPDLIAEIDAAV-KQANLAVSH------------------AESIRKFRILP
 RCE10267        ----------KITAEHIKKAC-KRGMAHYKV------------------PKYVLIKKESE
 RAG48341        DRSRTIVQRSISGEEEIVAVD-ENLVENNAVKELYAKIVDD-VNSRLAKHETIKKFKILP
 RML00425        ---------ATIDEDAIKAYV-RDHLARYKV------------------PREVIFLEELP
 REC01658        ----------SLSLEEVVAFFSRKRVAKYKY------------------PEHIVVIEKLP
 RHI00001        --------IKYHDRLELLKNSDILKMFEHRIN--------A-VQKELAHFEQVKKFTLLS
 RPG00364        -----LEQARTMSVDEMAANPEINRLMMARIEAAQDS---------LAAYEKVKYITLLA
 RRC00290        ----------TITPEELMAHAKRHIHERAAV------------------PKHIEVLDELP
 RAA00428        ---LEETIKWEVIDKVNRELPEWKRVVGFKIVKTELPKTRLGKLRRFLLPQIYEKAEEIK
 RBB00164        --------VSFSSRSDLLANEDVNKLYSKHISDTINTKLG-----FKNFEKIVGFVLLQD
 RTP00336        ----------TECMEELLVNPAVVKFFEQEIAKRISLENG------FKIFERINRFVLLP
 RBB00597        -----QKIFDANNRRQIIANNIVLKAINDEIKKLINKANG------FKPFEQILKFTLLE
 RCY06372        TVP----EPSASSEGMQASGLYDPQVVGLMRSELHREVRDR---PGYRADDQIKDFRFIP
 RPG00996        -----------ISPDQAWAYIERSRAELNGQVG--------------AYEKITAFVRHDE
                                                                             
 
 RBS01824        M----------TASGKIQKYKLREKTIEMFNLSSSQ------------------------
 RTH01137        L----------TASGKVQKFKLREMAVELLKKKEQP------------------------
 RMT04593        M----------TVTGKVRKVEMRQQALEYLRGQQ--------------------------
 RPA00539        M----------TVTGKIQKFRMREISIEEIRLLALRQGRD--------------------
 RAG50253        K----------SAVGKILRRVLRE---EEIKKIKG-------------------------
 RDR02856        K----------TXVGXTLRRQLAAXARERLKKEKAEKSA---------------------
 RBS02850        K----------TAVGKILRRRLLE---EETENHHIK------------------------
 REC05109        K----------SNVGKILRRELRD---EARGKVDNKA-----------------------
 RHI08067        K----------TNVGKILRRVLRD---EEIAKRPKH------------------------
 RNG00581        K----------SNVGKILRRELR----QSAGK----------------------------
 RNM01387        K----------SNVGKILRRELR----QSTGK----------------------------
 RPA06952        T----------TNVGKILRRELRD---EELKKAGQK------------------------
 RPA06953        M----------TPVGKILRRELR-----EIA-----------------------------
 RNG01013        R----------NATGKVLKRVLK----EQFEGNK--------------------------
 RNM01768        R----------NATGKVLKRVLK----EQFDGNK--------------------------
 RML00516        VD-FTEQTGELTPTMKVKRNVVAQKFASDIEAIYEKD-----------------------
 RMT04495        VD-FTEDTGELTPTMKVKRKVVAEKFASDIEAIYNKE-----------------------
 RCE10267        FP--------LTISGKVKKFEIQKISKELLGLGTVKSHFTEAVDN---------------
 RAG48341        EA-FSLEKGEITPTLKKRRHVILKRYEKFIEEMYKR------------------------
 RML00425        R----------NPTGKVLKRELR-----DFEVH---------------------------
 REC01658        R----------TTSGKIQKFLLRKDIMRRLTQDVCEEIE---------------------
 RHI00001        QA-FSIKLGEITPTLKLRRKVILERYRKQIEAMYHSQEA---------------------
 RPG00364        EP-FTLEKGELTETMKLKRRVINEHYAEAIEKMYL-------------------------
 RRC00290        K----------TAVGKIFKPDLRKRAITRVLDAALAEAGVPVQVVAVVEDKKRGLVAQLA
 RAA00428        EEKTEDYSVFETEEGRIIKEFLEKISQKEVKPGDHLEIDLGLDSLAKVELLGFIETNFGV
 RBB00164        PFTIG---EELTNTLKLKRYYISKKYEDKIKLIFSKSDLDLNGY----------------
 RTP00336        KVFEVG--VELSAKQEVMRHRVADLYAKEIAQLFS-------------------------
 RBB00597        KPFEVG--KEMSIKMDIKRSYILNFYKNEIKNLFI-------------------------
 RCY06372        AP-FSLENGMMTQTLKLKRPVVTQTYQHLIDEMF--------------------------
 RPG00996        EF-----EK--TPKHSIKRFLYT-------------------------------------
                            .      :                                         
 
 RBS01824        ------------------------------------------------------------
 RTH01137        ------------------------------------------------------------
 RMT04593        ------------------------------------------------------------
 RPA00539        ------------------------------------------------------------
 RAG50253        ------------------------------------------------------------
 RDR02856        ------------------------------------------------------------
 RBS02850        ------------------------------------------------------------
 REC05109        ------------------------------------------------------------
 RHI08067        ------------------------------------------------------------
 RNG00581        ------------------------------------------------------------
 RNM01387        ------------------------------------------------------------
 RPA06952        ------------------------------------------------------------
 RPA06953        ------------------------------------------------------------
 RNG01013        ------------------------------------------------------------
 RNM01768        ------------------------------------------------------------
 RML00516        ------------------------------------------------------------
 RMT04495        ------------------------------------------------------------
 RCE10267        ------------------------------------------------------------
 RAG48341        ------------------------------------------------------------
 RML00425        ------------------------------------------------------------
 REC01658        ------------------------------------------------------------
 RHI00001        ------------------------------------------------------------
 RPG00364        ------------------------------------------------------------
 RRC00290        SSGEVDQEKMAHVLGQFTVPWAWAE-----------------------------------
 RAA00428        SLSEEELSKNLVVKDLIELVRSKKKSVDTKEVSWKDILTKAKPYELYHYPLIFELGRKLL
 RBB00164        ------------------------------------------------------------
 RTP00336        ------------------------------------------------------------
 RBB00597        ------------------------------------------------------------
 RCY06372        ------------------------------------------------------------
 RPG00996        ------------------------------------------------------------
                                                                             
 
 RBS01824        ------------------------------------------------------------
 RTH01137        ------------------------------------------------------------
 RMT04593        ------------------------------------------------------------
 RPA00539        ------------------------------------------------------------
 RAG50253        ------------------------------------------------------------
 RDR02856        ------------------------------------------------------------
 RBS02850        ------------------------------------------------------------
 REC05109        ------------------------------------------------------------
 RHI08067        ------------------------------------------------------------
 RNG00581        ------------------------------------------------------------
 RNM01387        ------------------------------------------------------------
 RPA06952        ------------------------------------------------------------
 RPA06953        ------------------------------------------------------------
 RNG01013        ------------------------------------------------------------
 RNM01768        ------------------------------------------------------------
 RML00516        ------------------------------------------------------------
 RMT04495        ------------------------------------------------------------
 RCE10267        ------------------------------------------------------------
 RAG48341        ------------------------------------------------------------
 RML00425        ------------------------------------------------------------
 REC01658        ------------------------------------------------------------
 RHI00001        ------------------------------------------------------------
 RPG00364        ------------------------------------------------------------
 RRC00290        ------------------------------------------------------------
 RAA00428        KLYFKLYHRIDVRGLENLPKPPFIIAPNHQSYLDAFAIAAVLPKEIAHETYFLGDETYFR
 RBB00164        ------------------------------------------------------------
 RTP00336        ------------------------------------------------------------
 RBB00597        ------------------------------------------------------------
 RCY06372        ------------------------------------------------------------
 RPG00996        ------------------------------------------------------------
                                                                             
 
 RBS01824        ------------------------------------------------------------
 RTH01137        ------------------------------------------------------------
 RMT04593        ------------------------------------------------------------
 RPA00539        ------------------------------------------------------------
 RAG50253        ------------------------------------------------------------
 RDR02856        ------------------------------------------------------------
 RBS02850        ------------------------------------------------------------
 REC05109        ------------------------------------------------------------
 RHI08067        ------------------------------------------------------------
 RNG00581        ------------------------------------------------------------
 RNM01387        ------------------------------------------------------------
 RPA06952        ------------------------------------------------------------
 RPA06953        ------------------------------------------------------------
 RNG01013        ------------------------------------------------------------
 RNM01768        ------------------------------------------------------------
 RML00516        ------------------------------------------------------------
 RMT04495        ------------------------------------------------------------
 RCE10267        ------------------------------------------------------------
 RAG48341        ------------------------------------------------------------
 RML00425        ------------------------------------------------------------
 REC01658        ------------------------------------------------------------
 RHI00001        ------------------------------------------------------------
 RPG00364        ------------------------------------------------------------
 RRC00290        ------------------------------------------------------------
 RAA00428        NPITSTFGKLAHVITVNVNKGLKESLQKTAYALMSGKVVVIFPEGARTRTEELMEFKKGV
 RBB00164        ------------------------------------------------------------
 RTP00336        ------------------------------------------------------------
 RBB00597        ------------------------------------------------------------
 RCY06372        ------------------------------------------------------------
 RPG00996        ------------------------------------------------------------
                                                                             
 
 RBS01824        ------------------------------------------------------------
 RTH01137        ------------------------------------------------------------
 RMT04593        ------------------------------------------------------------
 RPA00539        ------------------------------------------------------------
 RAG50253        ------------------------------------------------------------
 RDR02856        ------------------------------------------------------------
 RBS02850        ------------------------------------------------------------
 REC05109        ------------------------------------------------------------
 RHI08067        ------------------------------------------------------------
 RNG00581        ------------------------------------------------------------
 RNM01387        ------------------------------------------------------------
 RPA06952        ------------------------------------------------------------
 RPA06953        ------------------------------------------------------------
 RNG01013        ------------------------------------------------------------
 RNM01768        ------------------------------------------------------------
 RML00516        ------------------------------------------------------------
 RMT04495        ------------------------------------------------------------
 RCE10267        ------------------------------------------------------------
 RAG48341        ------------------------------------------------------------
 RML00425        ------------------------------------------------------------
 REC01658        ------------------------------------------------------------
 RHI00001        ------------------------------------------------------------
 RPG00364        ------------------------------------------------------------
 RRC00290        ------------------------------------------------------------
 RAA00428        AILARELGVPIVPVAIEGAYEAWSVYDKFPKPKKIKIMFGKPVDPDEKSYEEITKELYEW
 RBB00164        ------------------------------------------------------------
 RTP00336        ------------------------------------------------------------
 RBB00597        ------------------------------------------------------------
 RCY06372        ------------------------------------------------------------
 RPG00996        ------------------------------------------------------------
                                                                             
 
 RBS01824        ------------
 RTH01137        ------------
 RMT04593        ------------
 RPA00539        ------------
 RAG50253        ------------
 RDR02856        ------------
 RBS02850        ------------
 REC05109        ------------
 RHI08067        ------------
 RNG00581        ------------
 RNM01387        ------------
 RPA06952        ------------
 RPA06953        ------------
 RNG01013        ------------
 RNM01768        ------------
 RML00516        ------------
 RMT04495        ------------
 RCE10267        ------------
 RAG48341        ------------
 RML00425        ------------
 REC01658        ------------
 RHI00001        ------------
 RPG00364        ------------
 RRC00290        ------------
 RAA00428        IKSMLEFLKKES
 RBB00164        ------------
 RTP00336        ------------
 RBB00597        ------------
 RCY06372        ------------
 RPG00996        ------------
                             
 

The following is our ASCII-rendition of the Newick-formatted tree that ClustalW also generates.

               ,--------------------------------------------------- RAA00428: [Aquifex aeolicus]   - LONG-CHAIN-FATTY-ACID--COA LIGASE (EC 6.2.1.3)
              |
              |
            ,-|
            | |
            | |
            | `-------------------------------------------------------- RPG00996: [Porphyromonas gingivalis]   - LONG-CHAIN-FATTY-ACID--COA LIGASE (EC 6.2.1.3)
            |
            |
      ,-----|
      |     |
      |     |
      |     |         ,---------------------------------------------- RAG48341: [Archaeoglobus fulgidus]   - LONG-CHAIN-FATTY-ACID--COA LIGASE (EC 6.2.1.3)
      |     |         |
      |     |         |
      |     |       ,-|
      |     |       | |
      |     |       | |
      |     |       | |                                   ,------------ RML00516: [Mycobacterium leprae]   - LONG-CHAIN-FATTY-ACID--COA LIGASE (EC 6.2.1.3)
      |     |       | |                                   |
      |     |       | |                                   |
      |     |       | `-----------------------------------|
      |     |       |                                     |
      |     |       |                                     |
      |     |       |                                     `----------- RMT04495: [Mycobacterium tuberculosis]   - LONG-CHAIN-FATTY-ACID--COA LIGASE (EC 6.2.1.3)
      |     |       |
      |     |       |
      |     |   ,---|
      |     |   |   |
      |     |   |   |
      |     |   |   |         ,------------------------------------------ RHI00001: [Haemophilus influenzae]   - LONG-CHAIN-FATTY-ACID--COA LIGASE (EC 6.2.1.3)
      |     |   |   |         |
      |     |   |   |         |
      |     |   |   `---------|
      |     |   |             |
      |     |   |             |
      |     |   |             `-------------------------------------------- RPG00364: [Porphyromonas gingivalis]   - LONG-CHAIN-FATTY-ACID--COA LIGASE (EC 6.2.1.3)
      |     |   |
      |     |   |
      |     `---|
      |         |
      |         |
      |         |        ,--------------------------------------------- RBB00164: [Borrelia burgdorferi]   - LONG-CHAIN-FATTY-ACID--COA LIGASE (EC 6.2.1.3)
      |         |        |
      |         |        |
      |         |      ,-|
      |         |      | |
      |         |      | |
      |         |      | `--------------------------------------------- RTP00336: [Treponema pallidum]   - LONG-CHAIN-FATTY-ACID--COA LIGASE (EC 6.2.1.3)
      |         |      |
      |         |      |
      |         |  ,---|
      |         |  |   |
      |         |  |   |
      |         |  |   `----------------------------------------------- RBB00597: [Borrelia burgdorferi]   - LONG-CHAIN-FATTY-ACID--COA LIGASE (EC 6.2.1.3)
      |         |  |
      |         |  |
      |         `--|
      |            |
      |            |
      |            `-------------------------------------------------- RCY06372: [Synechocystis sp.]   - LONG-CHAIN-FATTY-ACID--COA LIGASE (EC 6.2.1.3)
      |
      |
    ,-|
    | |
    | |
    | |             ,------------------------------------ RAG50253: [Archaeoglobus fulgidus]   - LONG-CHAIN-FATTY-ACID--COA LIGASE (EC 6.2.1.3)
    | |             |
    | |             |
    | |           ,-|
    | |           | |
    | |           | |
    | |           | `-------------------------------------- RDR02856: [Deinococcus radiodurans]   - LONG-CHAIN-FATTY-ACID--COA LIGASE (EC 6.2.1.3)
    | |           |
    | |           |
    | |     ,-----|
    | |     |     |
    | |     |     |
    | |     |     `--------------------------------------- RBS02850: [Bacillus subtilis]   - LONG-CHAIN-FATTY-ACID--COA LIGASE (EC 6.2.1.3)
    | |     |
    | |     |
    | |  ,--|
    | |  |  |
    | |  |  |
    | |  |  |                     ,------------------------ REC05109: [Escherichia coli]   - LONG-CHAIN-FATTY-ACID--COA LIGASE (EC 6.2.1.3)
    | |  |  |                     |
    | |  |  |                     |
    | |  |  |              ,------|
    | |  |  |              |      |
    | |  |  |              |      |
    | |  |  |              |      `-------------------------- RHI08067: [Haemophilus influenzae]   - LONG-CHAIN-FATTY-ACID--COA LIGASE (EC 6.2.1.3)
    | |  |  |              |
    | |  |  |              |
    | |  |  |            ,-|
    | |  |  |            | |
    | |  |  |            | |
    | |  |  |            | |                             ,--- RNG00581: [Neisseria gonorrhoeae]   - LONG-CHAIN-FATTY-ACID--COA LIGASE (EC 6.2.1.3)
    | |  |  |            | |                             |
    | |  |  |            | |                             |
    | |  |  |            | `-----------------------------|
    | |  |  |            |                               |
    | |  |  |            |                               |
    | |  |  |            |                               `-- RNM01387: [Neisseria meningitidis]   - LONG-CHAIN-FATTY-ACID--COA LIGASE (EC 6.2.1.3)
    | |  |  |            |
    | |  |  |            |
    | |  |  `------------|
    | |  |               |
    | |  |               |
    | |  |               |     ,---------------------------- RPA06952: [Pseudomonas aeruginosa]   - LONG-CHAIN-FATTY-ACID--COA LIGASE (EC 6.2.1.3)
    | |  |               |     |
    | |  |               |     |
    | |  |               `-----|
    | |  |                     |
    | |  |                     |
    | |  |                     `---------------------------- RPA06953: [Pseudomonas aeruginosa]   - LONG-CHAIN-FATTY-ACID--COA LIGASE (EC 6.2.1.3)
    | |  |
    | |  |
    | `--|
    |    |
    |    |
    |    |                                            ,- RNG01013: [Neisseria gonorrhoeae]   - LONG-CHAIN-FATTY-ACID--COA LIGASE (EC 6.2.1.3)
    |    |                                            |
    |    |                                            |
    |    `--------------------------------------------|
    |                                                 |
    |                                                 |
    |                                                 `---- RNM01768: [Neisseria meningitidis]   - LONG-CHAIN-FATTY-ACID--COA LIGASE (EC 6.2.1.3)
    |
    |
  ,-|
  | |
  | |
  | `------------------------------------------------------ RRC00290: [Rhodobacter capsulatus]   - LONG-CHAIN-FATTY-ACID--COA LIGASE (EC 6.2.1.3)
  |
  |
 -|
  |
  |
  |                    ,-------------------------------- RBS01824: [Bacillus subtilis]   - LONG-CHAIN-FATTY-ACID--COA LIGASE (EC 6.2.1.3)
  |                    |
  |                    |
  |               ,----|
  |               |    |
  |               |    |
  |               |    `------------------------------ RTH01137: [Methanobacterium thermoautotrophicum]   - LONG-CHAIN-FATTY-ACID--COA LIGASE (EC 6.2.1.3)
  |               |
  |               |
  |         ,-----|
  |         |     |
  |         |     |
  |         |     |     ,-------------------------------- RMT04593: [Mycobacterium tuberculosis]   - LONG-CHAIN-FATTY-ACID--COA LIGASE (EC 6.2.1.3)
  |         |     |     |
  |         |     |     |
  |         |     `-----|
  |         |           |
  |         |           |
  |         |           `-------------------------------- RPA00539: [Pseudomonas aeruginosa]   - LONG-CHAIN-FATTY-ACID--COA LIGASE (EC 6.2.1.3)
  |         |
  |         |
  | ,-------|
  | |       |
  | |       |
  | |       `----------------------------------------------- RCE10267: [Caenorhabditis elegans]   - LONG-CHAIN-FATTY-ACID--COA LIGASE (EC 6.2.1.3)
  | |
  | |
  |-|
  | |
  | |
  | `-------------------------------------------------- REC01658: [Escherichia coli]   - LONG-CHAIN-FATTY-ACID--COA LIGASE (EC 6.2.1.3)
  |
  |
  `------------------------------------------------- RML00425: [Mycobacterium leprae]   - LONG-CHAIN-FATTY-ACID--COA LIGASE (EC 6.2.1.3)